PDB entry 1ypr

View 1ypr on RCSB PDB site
Description: saccharomyces cerevisiae (yeast) profilin
Class: actin-binding protein
Keywords: actin-binding protein, profilin, cytoskeleton
Deposited on 1997-06-26, released 1997-12-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.168
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ypra_
  • Chain 'B':
    Compound: Profilin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yprb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yprA (A:)
    swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
    hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
    igvqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yprB (B:)
    swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
    hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
    igvqy