PDB entry 1ypp

View 1ypp on RCSB PDB site
Description: acid anhydride hydrolase
Class: hydrolase
Keywords: hydrolase
Deposited on 1996-05-29, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-End)
      • conflict (72)
      • conflict (265)
    Domains in SCOPe 2.07: d1yppa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00817 (0-End)
      • conflict (72)
      • conflict (265)
    Domains in SCOPe 2.07: d1yppb_
  • Heterogens: MN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yppA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtakgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yppA (A:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtakgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yppB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtakgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffisgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yppB (B:)
    tyttrqigakntleykvyiekdgkpvsafhdiplyadkennifnmvveiprwtnakleit
    keetlnpiiqdtakgklrfvrncfphhgyihnygafpqtwedpnvshpetkavgdndpid
    vleigetiaytgqvkqvkalgimalldegetdwkviaidindplapklndiedvekyfpg
    llratnewfriykipdgkpenqfafsgeaknkkyaldiikethdswkqliagkssdskgi
    dltnvtlpdtptyskaasdaippaspkadapidksidkwffi