PDB entry 1ypn

View 1ypn on RCSB PDB site
Description: reduced form hydroxymethylbilane synthase (k59q mutant) crystal structure after 2 hours in a flow cell determined by time-resolved laue diffraction
Class: transferase
Keywords: biosynthesis of linear tetrapyrrole, all alpha/beta, transferase
Deposited on 1998-06-26, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxymethylbilane synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06983
      • engineered (58)
    Domains in SCOPe 2.07: d1ypna1, d1ypna2
  • Heterogens: DPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ypnA (A:)
    mldnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvildtplakvggqg
    lfvkelevallenradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalp
    agsivgtsslrrqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlgle
    sriraalppeislpavgqgavgiecrlddsrtrellaalnhhetalrvtaeramntrleg
    gcqvpigsyaelidgeiwlralvgapdgsqiirgerrgapqdaeqmgislaeellnngar
    eilaevyngdapa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypnA (A:)
    dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvgqglfvkelevalle
    nradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpagsivgtsslrr
    qcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesriraalppeis
    lpavgqgavgiecrlddsrtrellaalnhhetalrvtaeramntrleggcqvpigsyael
    idgeiwlralvgapdgsqiirgerrgapqdaeqmgislaeellnngareilaev