PDB entry 1ypi

View 1ypi on RCSB PDB site
Description: structure of yeast triosephosphate isomerase at 1.9-angstroms resolution
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase(intramolecular oxidoreductse)
Deposited on 1990-01-12, released 1991-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ypia_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ypib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypiA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypiB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilghserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn