PDB entry 1ypf

View 1ypf on RCSB PDB site
Description: crystal structure of guac (ba5705) from bacillus anthracis at 1.8 a resolution
Deposited on 2005-01-31, released 2006-02-14
The last revision was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GMP reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: guaC
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GMP reductase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: guaC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ypfA (A:)
    gsshhhhhhmgnvfdyediqlipakcivnsrsecdttvtlgkhkfklpvvpanmqtiide
    riatylaennyfyimhrfqpekrisfirdmqsrgliasisvgvkedeyefvqqlaaehlt
    peyitidiahghsnavinmiqhikkhlpesfviagnvgtpeavrelenagadatkvgigp
    gkvcitkiktgfgtggwqlaalrwcakaaskpiiadggirtngdvaksirfgatmvmigs
    lfagheespgetiekdgklykeyfgsasefqkgekknvegkkmfvehkgsledtliemeq
    dlqssisyaggtkldsirtvdyvvvknsifngdkvy
    

    Sequence, based on observed residues (ATOM records):
    >1ypfA (A:)
    nvfdyediqlipakcivnsrsecdttvtlgkhkfklpvvpanmqtiideriatylaenny
    fyimhrfqpekrisfirdmqsrgliasisvgvkedeyefvqqlaaehltpeyitidiahg
    hsnavinmiqhikkhlpesfviagnvgtpeavrelenagadatkvgigpgkvcitkiktg
    fgtggwqlaalrwcakaaskpiiadggirtngdvaksirfgatmvmigslfagheespge
    tinvegkkmfvehkgsledtliemeqdlqssisyaggtkldsirtvdyvvvknsi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ypfB (B:)
    gsshhhhhhmgnvfdyediqlipakcivnsrsecdttvtlgkhkfklpvvpanmqtiide
    riatylaennyfyimhrfqpekrisfirdmqsrgliasisvgvkedeyefvqqlaaehlt
    peyitidiahghsnavinmiqhikkhlpesfviagnvgtpeavrelenagadatkvgigp
    gkvcitkiktgfgtggwqlaalrwcakaaskpiiadggirtngdvaksirfgatmvmigs
    lfagheespgetiekdgklykeyfgsasefqkgekknvegkkmfvehkgsledtliemeq
    dlqssisyaggtkldsirtvdyvvvknsifngdkvy
    

    Sequence, based on observed residues (ATOM records):
    >1ypfB (B:)
    gnvfdyediqlipakcivnsrsecdttvtlgkhkfklpvvpanmqtiideriatylaenn
    yfyimhrfqpekrisfirdmqsrgliasisvgvkedeyefvqqlaaehltpeyitidiah
    ghsnavinmiqhikkhlpesfviagnvgtpeavrelenagadatkvgigpgkvcitkikt
    gfgtggwqlaalrwcakaaskpiiadggirtngdvaksirfgatmvmigslfagheespg
    etiekegkkmfvehkgsledtliemeqdlqssisyaggtkldsirtvdyvvvkns