PDB entry 1ypd

View 1ypd on RCSB PDB site
Description: thdp dependent pyruvate decarboyxlase from yeast (form b)
Class: lyase
Keywords: thiamine pyruvate, pyruvamide, lyase
Deposited on 1998-03-09, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-02-04, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate decarboxylase (form b)
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • PDB 1YPD (304-555)
    Domains in SCOPe 2.07: d1ypda1, d1ypda2, d1ypda3
  • Chain 'B':
    Compound: pyruvate decarboxylase (form b)
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • PDB 1YPD (304-555)
    Domains in SCOPe 2.07: d1ypdb1, d1ypdb2, d1ypdb3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ypdA (A:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqf
    pavvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqkllttiadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
    pvfdapqnlveqakltaatnakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypdA (A:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpshhtlgngdftvfhrmsan
    isettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakllqtpidmslkp
    ndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfpavvtpmgkgs
    ideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysyktknivefhs
    dhmkirnatfpgvqmkfvlqkllttiadaakgykpvavpartpanaavpastplkqewmw
    nqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaee
    idpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiq
    gwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlve
    qaklt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ypdB (B:)
    mseitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadg
    yarikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgng
    dftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakl
    lqtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqf
    pavvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsys
    yktknivefhsdhmkirnatfpgvqmkfvlqkllttiadaakgykpvavpartpanaavp
    astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
    atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
    hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
    pvfdapqnlveqakltaatnakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ypdB (B:)
    seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
    arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsisaqakqlllhhtlgngd
    ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
    qtpidmslkpndaesekevidtilalvkdaknpviladaccsrhdvkaetkklidltqfp
    avvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallnivefhsdhmki
    rnatfpgvqmkfvlqkllttiadaakgykpvavpartpanaavpastplkqewmwnqlgn
    flqegdvviaetgtsafginqttfpnntygisqvlwgsigfttgatlgaafaaeeidpkk
    rvilfigdgslqltvqeistmirwglkpylfvlnndgytieklihgpkaqyneiqgwdhl
    sllptfgakdyethrvattgewdkltqdksfndnskirmieimlpvfdapqnlveqaklt