PDB entry 1ypb

View 1ypb on RCSB PDB site
Description: direct observation of better hydration at the n-terminus of an alpha-helix with glycine rather than alanine as n-cap
Class: proteinase inhibitor(chymotrypsin)
Keywords: proteinase inhibitor(chymotrypsin)
Deposited on 1993-01-10, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: chymotrypsin inhibitor 2
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01053 (1-63)
      • conflict (11)
      • conflict (13-14)
    Domains in SCOPe 2.08: d1ypbi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ypbI (I:)
    mktewpelvgkgvaaakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaqv
    prvg