PDB entry 1yp7

View 1yp7 on RCSB PDB site
Description: Van der Waals Interactions Dominate Hydrophobic Association in a Protein Binding Site Occluded From Solvent Water
Class: ligand binding protein
Keywords: lipocalin; beta-barrel; mup1; 2-methoxy-3-isobutylpyrazine, ligand binding protein
Deposited on 2005-01-30, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major urinary protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: MUP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11588 (12-End)
      • engineered (61)
      • engineered (131)
      • engineered (151)
    Domains in SCOPe 2.08: d1yp7a_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yp7A (A:)
mrgshhhhhhgseeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvl
ekslvlkfhtvrdeecselsmvadktekageysvtydgfntftipktdydnflmahline
kdgetfqlmglfgrepdlssdikerfaqlceehgilreniidlsnanrclqare

    Sequence, based on observed residues (ATOM records): (download) 
    >1yp7A (A:)
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmglf
grepdlssdikerfaqlceehgilreniidlsnanrc