PDB entry 1yp5

View 1yp5 on RCSB PDB site
Description: Yeast Myo5 SH3 domain, tetragonal crystal form
Class: contractile protein
Keywords: SH3 domain, CONTRACTILE PROTEIN
Deposited on 2005-01-29, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.192
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-5 isoform
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yp5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yp5A (A:)
    pmfeaaydfpgsgspselplkkgdviyitreepsgwslgklldgskegwvptaymkph