PDB entry 1yp4

View 1yp4 on RCSB PDB site
Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ADP-glucose
Class: transferase
Keywords: ADP-glucose pyrophosphorylase/ADP-glucose complex
Deposited on 2005-01-29, released 2005-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yp4a1, d1yp4a2
  • Chain 'B':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yp4b1, d1yp4b2
  • Chain 'C':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yp4c1, d1yp4c2
  • Chain 'D':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yp4d1, d1yp4d2
  • Heterogens: SO4, ADQ, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yp4A (A:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp4A (A:)
    tcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniski
    yvltqfnsaslnrhlsrayagfvevlaaqqspenpdwfqgtadavrqylwlfeehtvley
    lilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekp
    qgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevi
    pgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylp
    pskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrk
    llaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtv
    ikdalipsgiii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yp4B (B:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp4B (B:)
    cldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniskiy
    vltqfnsaslnrhlsrayasnmnegfvevlaaqqspenfqgtadavrqylwlfeehtvle
    ylilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaek
    pqgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsev
    ipgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqpryl
    ppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadr
    kllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivt
    vikdalipsgiii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yp4C (C:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp4C (C:)
    tcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniski
    yvltqfnsaslnrhlsrayasegfvevlaaqqspenpdwfqgtadavrqylwlfeehtvl
    eylilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefae
    kpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgse
    vipgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqpry
    lppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdad
    rkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgiv
    tvikdalipsgiii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yp4D (D:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp4D (D:)
    cldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniskiy
    vltqfnsaslnrhlsrayegfvevlaaqqspeqgtadavrqylwlfeehtvleylilagd
    hlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekpqgeqlq
    amkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevipgatsl
    gmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylppskmld
    advtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrkllaakg
    svpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtvikdali
    psgiii