PDB entry 1yp3

View 1yp3 on RCSB PDB site
Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase in complex with ATP
Class: transferase
Keywords: ADP-glucose pyrophosphorylase, ADP-glucose synthase, AGPASE B, Alpha-D-glucose-1-phosphate adenyl transferase
Deposited on 2005-01-29, released 2005-03-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.175
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yp3a1, d1yp3a2
  • Chain 'B':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yp3b1, d1yp3b2
  • Chain 'C':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yp3c1, d1yp3c2
  • Chain 'D':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yp3d1, d1yp3d2
  • Heterogens: SO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yp3A (A:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp3A (A:)
    qtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsnisk
    iyvltqfnsaslnrhlsrayegfvevlaaqqspenpdwfqgtadavrqylwlfeehtvle
    ylilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaek
    pqgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsev
    ipgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqpryl
    ppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadr
    kllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivt
    vikdalipsgiii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yp3B (B:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp3B (B:)
    tcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniski
    yvltqfnsaslnrhlsrayasnnegfvevlaaqqspenqgtadavrqylwlfeehtvley
    lilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekp
    qgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevi
    pgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylp
    pskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrk
    llaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtv
    ikdalipsgiii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yp3C (C:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp3C (C:)
    qtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsnisk
    iyvltqfnsaslnrhlsrayasegfvevlaaqqspenpdwfqgtadavrqylwlfeehtv
    leylilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefa
    ekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgs
    evipgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqpr
    ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda
    drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi
    vtvikdalipsgiii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yp3D (D:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp3D (D:)
    ldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvsnclnsniskiyv
    ltqfnsaslnrhlsraynegfvevlaaqqspegtadavrqylwlfeehtvleylilagdh
    lyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekpqgeqlqa
    mkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevipgatslg
    mrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylppskmlda
    dvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrkllaakgs
    vpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtvikdalip
    sgiii