PDB entry 1yp1

View 1yp1 on RCSB PDB site
Description: Crystal structure of a non-hemorrhagic fibrin(ogen)olytic metalloproteinase from venom of Agkistrodon acutus
Class: hydrolase
Keywords: FII crystal structure, HYDROLASE
Deposited on 2005-01-28, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fii
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YP1 (0-End)
    Domains in SCOPe 2.07: d1yp1a_
  • Chain 'B':
    Compound: knl
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YP1 (0-2)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yp1A (A:)
    aspqvsvtlqlvvdssmfakyngdakkivtvldtrvnimksifkpllllitlsgiemwts
    kdlitvkpagdltlslfadwrqtlllsrilndnaqlqtavdfrgavvglafvgtmcnaky
    sagiiqdfsaipllmavvmahelghnlgmlhddgyscdcdvcimapslssdptkvfsncs
    lilyedflsneepdcidnasnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp1A (A:)
    aspqvsvtlqlvvdssmfakyngdakkivtvldtrvnimksifkpllllitlsgiemwts
    kdlitvkpagdltlslfadwrqtlllsrilndnaqlqtavdfrgavvglafvgtmcnaky
    sagiiqdfsaipllmavvmahelghnlgmlhddgyscdcdvcimapslssdptkvfsncs
    lilyedflsneepdcidna
    

  • Chain 'B':
    No sequence available.