PDB entry 1yp0

View 1yp0 on RCSB PDB site
Description: structure of the steroidogenic factor-1 ligand binding domain bound to phospholipid and a shp peptide motif
Deposited on 2005-01-28, released 2005-04-19
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear receptor subfamily 5, group A, member 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear receptor subfamily 0, group B, member 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yp0A (A:)
    nvpelilqllqlepeedqvrarivgclqepaksrsdqpapfsllcrmadqtfisivdwar
    rcmvfkelevadqmtllqncwsellvldhiyrqvqygkedsillvtgqevelstvavqag
    sllhslvlraqelvlqlhalqldrqefvclkflilfsldvkflnnhslvkdaqekanaal
    ldytlchyphcgdkfqqlllclvevralsmqakeylyhkhlgnemprnnlliemlqakq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yp0B (B:)
    hptilytllspg