PDB entry 1yoz

View 1yoz on RCSB PDB site
Description: Predicted coding region AF0941 from Archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: af0941, apc5573, midwest center for structural genomics, mcsg, protein structure initiative, psi
Deposited on 2005-01-28, released 2005-02-08
The last revision prior to the SCOP 1.73 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF0941
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29321 (2-115)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1yoza1
  • Chain 'B':
    Compound: Hypothetical protein AF0941
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29321 (2-115)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1yozb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yozA (A:)
ghmlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeev
qrnfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev

    Sequence, based on observed residues (ATOM records): (download) 
    >1yozA (A:)
ghmlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeev
qrnfyllktyvvsqlsihferlkefaeskgekkldpevineialyidrvekev

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yozB (B:)
ghmlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeev
qrnfyllktyvvsqlsihferlkefaeskgfkiekkldpevineialyidrvekev