PDB entry 1yoy

View 1yoy on RCSB PDB site
Description: Predicted coding region AF1432 from Archaeoglobus Fulgidus
Class: structural genomics, unknown function
Keywords: af1432, apc5594, midwest center for structural genomics, mcsg, protein structure initiative, psi, structural genomics, unknown function
Deposited on 2005-01-28, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AF1432
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yoya1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yoyA (A:)
    ghmciikpmddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksg
    esvekackaataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvev
    yvsdadklelafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoyA (A:)
    mddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksgesvekack
    aataalfhdlheareeqlswmeskpdfsdvevyvsdadklelafqgveysqqvsyairfa
    envelktdaakeiyrvlmerknpvww