PDB entry 1yow

View 1yow on RCSB PDB site
Description: human steroidogenic factor 1 lbd with bound co-factor peptide
Deposited on 2005-01-28, released 2005-05-10
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.246
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroidogenic factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NR5A1, AD4BP, FTZF1, SF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13285 (2-End)
      • cloning artifact (1)
      • cloning artifact (7)
  • Chain 'B':
    Compound: TIF2 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1YOW (0-10)
  • Heterogens: P0E, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yowA (A:)
    gsnvpelmlqllqlepdedqvrarilgclqeptksrpdqpaafgllcrmadqtfisivdw
    arrcmvfkelevadqmtllqncwsellvfdhiyrqvqhgkegsillvtgqevelttvatq
    agsllhslvlraqelvlqllalqldrqefvclkfiilfsldlkflnnhilvkdaqekana
    alldytlchyphcgdkfqqlllclvevralsmqakeylyhkhlgnemprnnlliemlqak
    qt
    

    Sequence, based on observed residues (ATOM records):
    >1yowA (A:)
    snvpelmlqllqlepdedqvrarilgclqepaafgllcrmadqtfisivdwarrcmvfke
    levadqmtllqncwsellvfdhiyrqvqhgkegsillvtgqevelttvatqagsllhslv
    lraqelvlqllalqldrqefvclkfiilfsldlkflnnhilvkdaqekanaalldytlch
    yphcgdkfqqlllclvevralsmqakeylyhkhlgnemprnnlliemlqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yowB (B:)
    aqalaallaka