PDB entry 1yov

View 1yov on RCSB PDB site
Description: Insights into the Ubiquitin Transfer Cascade from the refined structure of the activating enzyme for NEDD8
Class: signaling protein
Keywords: ubiquitin, NEDD8, E1, APPBP1, UBA3, SIGNALING PROTEIN
Deposited on 2005-01-28, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APPBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yova_
  • Chain 'B':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE1C, UBA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yovb_
  • Chain 'C':
    Compound: amyloid protein-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APPBP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yovc_
  • Chain 'D':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE1C, UBA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yovd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yovA (A:)
    mklmaqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsf
    tiidgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndp
    sffcrftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpd
    naledlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripkty
    kekedfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcini
    tkqtpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaav
    gnhvakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmd
    npdneivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkdd
    yvhefcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yovA (A:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
    lirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yovB (B:)
    gsmavdggcgdtgdwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagg
    lgcellknlalsgfrqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpnc
    nvvphfnkiqdfndtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivpli
    dggtegfkgnarvilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwp
    keqpfgegvpldgddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnav
    iaavcatevfkiatsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfsps
    aklqevldyltnsaslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglv
    dgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yovB (B:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmk
    spaitatrtlylqseertrpnllavadvttpqtvlfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yovC (C:)
    mklmaqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsf
    tiidgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndp
    sffcrftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpd
    naledlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripkty
    kekedfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcini
    tkqtpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaav
    gnhvakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmd
    npdneivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkdd
    yvhefcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yovC (C:)
    keqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsge
    dagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvva
    tqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldkp
    fpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdlir
    qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila
    ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi
    gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm
    lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa
    ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yovD (D:)
    gsmavdggcgdtgdwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagg
    lgcellknlalsgfrqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpnc
    nvvphfnkiqdfndtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivpli
    dggtegfkgnarvilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwp
    keqpfgegvpldgddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnav
    iaavcatevfkiatsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfsps
    aklqevldyltnsaslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglv
    dgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yovD (D:)
    hvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsgfrqihvi
    dmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqf
    hiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarvilpgmta
    ciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldgddpehiq
    wifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkiatsayipl
    nnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmkspaitnr
    tlylqstsievadvttpqtvlf