PDB entry 1yop

View 1yop on RCSB PDB site
Description: The solution structure of Kti11p
Class: metal binding protein
Keywords: zinc finger
Deposited on 2005-01-28, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-05, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kti11p
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3E840 (0-82)
      • insertion (1)
    Domains in SCOP 1.73: d1yopa1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yopA (A:)
    mvstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfd
    kedlaeyyeeagihppepiaaaa