PDB entry 1yop

View 1yop on RCSB PDB site
Description: The solution structure of Kti11p
Class: metal binding protein
Keywords: zinc finger, METAL BINDING PROTEIN
Deposited on 2005-01-28, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Kti11p
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E840 (0-82)
    • insertion (1)
  Domains in SCOPe 2.08: d1yopa1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yopA (A:)
  mvstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfd
  kedlaeyyeeagihppepiaaaa