PDB entry 1yoo

View 1yoo on RCSB PDB site
Description: aspartate aminotransferase mutant atb17 with isovaleric acid
Deposited on 1998-06-26, released 1999-02-02
The last revision prior to the SCOP 1.71 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.162
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1yoo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yoo_ (-)
    mfenittapadpilgladllraderpgkidlgmgvyndetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    rrvwvsnpgwpthksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgtctlvaadsetvdrafsqmkaairvnyssppahgasvvatilgn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsftikqngmfffggltkeqvlr
    lreefgvyavasgrlnvagmtpdnlaplceaivavl