PDB entry 1yom

View 1yom on RCSB PDB site
Description: Crystal structure of Src kinase domain in complex with Purvalanol A
Class: transferase
Keywords: protein tyrosine kinase, TRANSFERASE
Deposited on 2005-01-27, released 2006-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-282)
      • engineered (91)
      • engineered (116)
    Domains in SCOPe 2.08: d1yoma_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-282)
      • engineered (91)
      • engineered (116)
    Domains in SCOPe 2.08: d1yomb_
  • Heterogens: P01, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yomA (A:)
    qtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqe
    aqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqi
    asgmayvermnyvhrdlraanilvgenlvckvadfglarliednewtarqgakfpikwta
    peaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpes
    lhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yomA (A:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
    kklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqiasgm
    ayvermnyvhrdlraanilvgenlvckvadfpikwtapeaalygrftiksdvwsfgillt
    elttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylq
    afledyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yomB (B:)
    qtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqe
    aqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqi
    asgmayvermnyvhrdlraanilvgenlvckvadfglarliednewtarqgakfpikwta
    peaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpes
    lhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yomB (B:)
    lakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvm
    kklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqiasgm
    ayvermnyvhrdlraanilvgenlvckvadffpikwtapeaalygrftiksdvwsfgill
    telttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeyl
    qafledyftstepqyqpgenl