PDB entry 1yol

View 1yol on RCSB PDB site
Description: Crystal structure of Src kinase domain in complex with CGP77675
Class: transferase
Keywords: protein tyrosine kinase, TRANSFERASE
Deposited on 2005-01-27, released 2006-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-282)
      • engineered (91)
      • engineered (116)
    Domains in SCOPe 2.07: d1yola_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (Start-282)
      • engineered (91)
      • engineered (116)
    Domains in SCOPe 2.07: d1yolb_
  • Heterogens: S03, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yolA (A:)
    qtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqe
    aqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqi
    asgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwta
    peaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpes
    lhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yolA (A:)
    akdaweipreslrlevklgqggevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
    rheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqiasgmayv
    ermnyvhrdlraanilvgenlvckvadpikwtapeaalygrftiksdvwsfgillteltt
    kgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqafle
    dyftstepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yolB (B:)
    qtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqe
    aqvmkklrheklvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqi
    asgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwta
    peaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpes
    lhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yolB (B:)
    aweipreslrlevklgqggevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrhe
    klvqlyavvseepiyivteymnkgslldflkgetgkylrlpqlvdmsaqiasgmayverm
    nyvhrdlraanilvgenlvckvadpikwtapeaalygrftiksdvwsfgilltelttkgr
    vpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqafledyf
    tstepqyqpgenl