PDB entry 1yoi

View 1yoi on RCSB PDB site
Description: cobalt myoglobin (oxy)
Deposited on 1996-06-14, released 1996-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1yoi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yoi_ (-)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg