PDB entry 1yoe

View 1yoe on RCSB PDB site
Description: Crystal structure of a the E. coli pyrimidine nucleoside hydrolase YbeK with bound ribose
Class: hydrolase
Keywords: Pyrimidine nucleoside hydrolase, bacterial nucleosidase, ribose, enzyme-product complex, Hydrolase
Deposited on 2005-01-27, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ybeK
    Species: Escherichia coli [TaxId:562]
    Gene: ybeK/rihA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41409 (12-321)
      • expression tag (10-11)
    Domains in SCOPe 2.08: d1yoea1, d1yoea2
  • Heterogens: RIB, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yoeA (A:)
    mrgshhhhhhgsalpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnv
    lrmltllnrtdipvaggavkplmreliiadnvhgesgldgpalpeptfapqnctavelma
    ktlresaepvtivstgpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyv
    dpeaaeivfqsgipvvmagldvthkaqihvedterfraignpvstivaelldffleyhkd
    ekwgfvgaplhdpctiawllkpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnat
    vmvdvdrqgfvdlladrlkfya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoeA (A:)
    gsalpilldcdpghddaiaivlalaspeldvkaitssagnqtpektlrnvlrmltllnrt
    dipvaggavkplmreliiaesgldgpalpeptfapqnctavelmaktlresaepvtivst
    gpqtnvalllnshpelhskiarivimggamglgnwtpaaefniyvdpeaaeivfqsgipv
    vmagldvthkaqihvedterfraignpvstivaelldfflekwgfvgaplhdpctiawll
    kpelftsverwvgvetqgkytqgmtvvdyyyltgnkpnatvmvdvdrqgfvdlladrlkf
    ya