PDB entry 1yob

View 1yob on RCSB PDB site
Description: C69A Flavodoxin II from Azotobacter vinelandii
Class: electron transport
Keywords: flavodoxin II, azotobacter vinelandii, alpha-beta fold, non-covalently bound FMN, ELECTRON TRANSPORT
Deposited on 2005-01-27, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavodoxin 2
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00324 (0-178)
      • engineered (68)
    Domains in SCOPe 2.07: d1yoba1
  • Chain 'B':
    Compound: Flavodoxin 2
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00324 (0-178)
      • engineered (68)
    Domains in SCOPe 2.07: d1yobb_
  • Heterogens: SO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yobA (A:)
    akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
    elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
    gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yobB (B:)
    akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
    elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
    gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl