PDB entry 1yoa

View 1yoa on RCSB PDB site
Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: flavoprotein, HB8, FAD, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-01-27, released 2005-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative flavoprotein
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SL73 (0-158)
  Domains in SCOPe 2.03: d1yoaa1
• Heterogens: FAD, FMN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yoaA (A:)
  mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
  ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
  rhlypggdhslvvaevveagvrreekplvmwdtgwfygg