PDB entry 1yoa

View 1yoa on RCSB PDB site
Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: flavoprotein, HB8, FAD, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-01-27, released 2005-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative flavoprotein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yoaa1
  • Heterogens: FAD, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yoaA (A:)
    mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
    ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
    rhlypggdhslvvaevveagvrreekplvmwdtgwfygg