PDB entry 1yo8

View 1yo8 on RCSB PDB site
Description: structure of the c-terminal domain of human thrombospondin-2
Deposited on 2005-01-26, released 2005-09-27
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombospondin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: THBS2, TSP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35442 (3-End)
      • modified residue (127)
      • modified residue (416)
      • modified residue (493)
      • modified residue (586)
      • modified residue (611)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yo8A (A:)
    adpdgclsnpcfpgaqcssfpdgswscgfcpvgflgngthcedldecalvpdicfstskv
    prcvntqpgfhclpcppryrgnqpvgvgleaaktekqvcepenpckdkthnchkhaeciy
    lghfsdpmykcecqtgyagdglicgedsdldgwpnlnlvcatnatyhcikdncphlpnsg
    qedfdkdgigdacdddddndgvtdekdncqllfnprqadydkdevgdrcdncpyvhnpaq
    idtdnngegdacsvdidgddvfnerdncpyvyntdqrdtdgdgvgdhcdncplvhnpdqt
    dvdndlvgdqcdnnedidddghqnnqdncpyisnanqadhdrdgqgdacdpdddndgvpd
    drdncrlvfnpdqedldgdgrgdickddfdndnipdiddvcpennaisetdfrnfqmvpl
    dpkgttqidpnwvirhqgkelvqtansdpgiavgfdefgsvdfsgtfyvntdrdddyagf
    vfgyqsssrfyvvmwkqvtqtywedqptraygysgvslkvvnsttgtgehlrnalwhtgn
    tpgqvrtlwhdprnigwkdytayrwhlthrpktgyirvlvhegkqvmadsgpiydqtyag
    grlglfvfsqemvyfsdlkyecrdiaaghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1yo8A (A:)
    dgclsnpcfpgaqcssfpdgswscgfcpvgflgngthcedldecalvpdicfstskvprc
    vntqpgfhclpcppryrgnqpvgvgleaaktekqvcepenpckdkthnchkhaeciylgh
    fsdpmykcecqtgyagdglicgedsdldgwpnlnlvcatnatyhcikdncphlpnsgqed
    fdkdgigdacdddddndgvtdekdncqllfnprqadydkdevgdrcdncpyvhnpaqidt
    dnngegdacsvdidgddvfnerdncpyvyntdqrdtdgdgvgdhcdncplvhnpdqtdvd
    ndlvgdqcdnnedidddghqnnqdncpyisnanqadhdrdgqgdacdpdddndgvpddrd
    ncrlvfnpdqedldgdgrgdickddfdndnipdiddvcpennaisetdfrnfqmvpldpk
    gttqidpnwvirhqgkelvqtansdpgiavgfdefgsvdfsgtfyvntdrdddyagfvfg
    yqsssrfyvvmwkqvtqtywedqptraygysgvslkvvnsttgtgehlrnalwhtgntpg
    qvrtlwhdprnigwkdytayrwhlthrpktgyirvlvhegkqvmadsgpiydqtyaggrl
    glfvfsqemvyfsdlkyecrd