PDB entry 1yo7

View 1yo7 on RCSB PDB site
Description: re-engineering topology of the homodimeric rop protein into a single- chain 4-helix bundle
Deposited on 2005-01-26, released 2005-02-15
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-55)
      • engineered (54)
      • see remark 999 (56-58)
      • see remark 999 (60-61)
      • see remark 999 (87-89)
      • see remark 999 (117-119)
    • Uniprot P03051 (62-86)
    • Uniprot P03051 (90-116)
  • Chain 'B':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-55)
      • engineered (54)
      • see remark 999 (56-58)
      • see remark 999 (60-61)
      • see remark 999 (87-89)
      • see remark 999 (117-119)
    • Uniprot P03051 (62-86)
    • Uniprot P03051 (90-116)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yo7A (A:)
    mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclasfkkng
    qideqadiceslhdhadelyrsclarfggskqektalnmarfirsqtltlleklnelakg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yo7B (B:)
    mtkqektalnmarfirsqtltlleklneldadeqadiceslhdhadelyrsclasfkkng
    qideqadiceslhdhadelyrsclarfggskqektalnmarfirsqtltlleklnelakg