PDB entry 1yo6

View 1yo6 on RCSB PDB site
Description: Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans
Class: oxidoreductase
Keywords: Tyrosine-dependent oxidoreductase (SDR family), Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2005-01-26, released 2005-02-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6a1
  • Chain 'B':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6b1
  • Chain 'C':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6c1
  • Chain 'D':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6d1
  • Chain 'E':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6e1
  • Chain 'F':
    Compound: Putative Carbonyl Reductase Sniffer
    Species: Caenorhabditis elegans
    Gene: sniffer
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1yo6f1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yo6A (A:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6A (A:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwveqstaelissfnkldnshngrffmrnlkpyef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yo6B (B:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6B (B:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgeqstaelissfnkldnshngrffmrnlkpyef
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yo6C (C:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6C (C:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtveqstaelissfnkldnshngrffmrnlkpyef
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yo6D (D:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6D (D:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgweqstaelissfnkldnshngrffmrnlkpyef
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yo6E (E:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6E (E:)
    spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltvt
    cdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvllt
    qkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainm
    fgrtlavdlkddnvlvvnfcpgveqstaelissfnkldnshngrffmrnlkpyef
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yo6F (F:)
    mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltv
    tcdksldtfvskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvll
    tqkllpllknaaskesgdqlsvsraavitissglgsitdntsgsaqfpvlayrmskaain
    mfgrtlavdlkddnvlvvnfcpgwvqtnlggknaaltveqstaelissfnkldnshngrf
    fmrnlkpyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo6F (F:)
    spgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksdsrvhvlpltvtcd
    ksldtfvskvgeivgsdsllinnagvllsygtntepnraviaeqldvnttsvvlltqkll
    pllknaaskedqlsvsraavitissglgsitdntsgsaqfpvlayrmskaainmfgrtla
    vdlkddnvlvvnfcpgwveqstaelissfnkldnshngrffmrnlkpyef