PDB entry 1yo5

View 1yo5 on RCSB PDB site
Description: Analysis of the 2.0A crystal structure of the protein-DNA complex of human PDEF Ets domain bound to the prostate specific antigen regulatory site
Class: transcription/DNA
Keywords: ETS; PROTEIN-DNA Complex; DOUBLE HELIX, TRANSCRIPTION/DNA COMPLEX
Deposited on 2005-01-26, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancer site of Prostate Specific Antigen Promoter Region
    Species: synthetic, synthetic
  • Chain 'B':
    Compound: Enhancer site of Prostate Specific Antigen Promoter Region
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: SAM pointed domain containing ets transcription factor
    Species: Homo sapiens [TaxId:9606]
    Gene: PDEF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yo5c1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yo5C (C:)
    gsldalgsqpihlwqflkelllkphsygrfirwlnkekgifkiedsaqvarlwgirknrp
    amnydklsrsirqyykkgiirkpdisqrlvyqfvhpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yo5C (C:)
    qpihlwqflkelllkphsygrfirwlnkekgifkiedsaqvarlwgirknrpamnydkls
    rsirqyykkgiirkpdisqrlvyqfvhp