PDB entry 1yo3

View 1yo3 on RCSB PDB site
Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum
Deposited on 2005-01-26, released 2005-03-15
Made obsolete by 5wof on 2017-08-16

The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
  • Chain 'B':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
  • Chain 'C':
    Compound: dynein light chain 1
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PFL0660W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R9 (19-101)
      • cloning artifact (17-18)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yo3A (A:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records):
    >1yo3A (A:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yo3B (B:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records):
    >1yo3B (B:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yo3C (C:)
    mgsshhhhhhssglvprgsvvknvdmteemqidaidcanqalqkynvekdiaahikkefd
    rkydptwhcvvgrnfgsyvthetknfiyfyigqvaillfksg
    

    Sequence, based on observed residues (ATOM records):
    >1yo3C (C:)
    gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
    yvthetknfiyfyigqvaillfksg