PDB entry 1ynz

View 1ynz on RCSB PDB site
Description: SH3 domain of yeast Pin3
Class: Protein binding
Keywords: SH3 domain, Protein binding
Deposited on 2005-01-26, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pin3p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_015480 (2-57)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1ynza1, d1ynza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynzA (A:)
    gmeyvealyqfdpqqdgdlglkpgdkvqlleklspewykgscngrtgifpanyvkpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynzA (A:)
    meyvealyqfdpqqdgdlglkpgdkvqlleklspewykgscngrtgifpanyvkpaf