PDB entry 1yny

View 1yny on RCSB PDB site
Description: Molecular Structure of D-Hydantoinase from a Bacillus sp. AR9: Evidence for mercury inhibition
Class: hydrolase
Keywords: TIM-barrel; hydantoinase; binuclear metal-binding; hydrolase, HYDROLASE
Deposited on 2005-01-26, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-hydantoinase
    Species: Bacillus sp. [TaxId:301298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynya1, d1ynya2
  • Chain 'B':
    Compound: D-hydantoinase
    Species: Bacillus sp. [TaxId:301298]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynyb1, d1ynyb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynyA (A:)
    mkkwirggtvvtaadtyqadvliegervvaighqlsvngaeeidatgcyvipggidphth
    ldmpfggtvtaddfftgtraaafggttsivdfcltkkgeslksaiatwhekargkavidy
    gfhlmiaeandqvleelesvissegitslkvfmayknvfqaddetlfktlvkakelgalv
    qvhaengdvldyltkkalaegntdpiyhaytrppeaegeatgraialtalagsqlyvvhv
    scasavqriaearekgwnvygetcpqylaldvsimdqpdfegakyvwspplrekwnqevl
    wsalkngilqtvgsdhcpfnfrgqkelgrgdftkipnggpliedrltilysegvrqgris
    lnqfvdisstkaaklfgmfprkgtiavgsdadivifdphvkrtlsvethhmnvdynpfeg
    mevygevvsvlsrgsfvvrdkqfvgqagsgqyikrttfeqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynyA (A:)
    kkwirggtvvtaadtyqadvliegervvaighqgaeeidatgcyvipggidphthldmpf
    ggtvtaddfftgtraaafggttsivdfcltkkgeslksaiatwhekargkavidygfhlm
    iaeandqvleelesvissegitslkvfmayknvfqaddetlfktlvkakelgalvqvhae
    ngdvldyltkkalaegntdpiyhaytrppeaegeatgraialtalagsqlyvvhvscasa
    vqriaearekgwnvygetcpqylaldvsimdqpdfegakyvwspplrekwnqevlwsalk
    ngilqtvgsdhcpfnfrgqkelgrgdftkipnggpliedrltilysegvrqgrislnqfv
    disstkaaklfgmfprkgtiavgsdadivifdphvkrtlsvethhmnvdynpfegmevyg
    evvsvlsrgsfvvrdkqfvgqagsgqyikrttfeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynyB (B:)
    mkkwirggtvvtaadtyqadvliegervvaighqlsvngaeeidatgcyvipggidphth
    ldmpfggtvtaddfftgtraaafggttsivdfcltkkgeslksaiatwhekargkavidy
    gfhlmiaeandqvleelesvissegitslkvfmayknvfqaddetlfktlvkakelgalv
    qvhaengdvldyltkkalaegntdpiyhaytrppeaegeatgraialtalagsqlyvvhv
    scasavqriaearekgwnvygetcpqylaldvsimdqpdfegakyvwspplrekwnqevl
    wsalkngilqtvgsdhcpfnfrgqkelgrgdftkipnggpliedrltilysegvrqgris
    lnqfvdisstkaaklfgmfprkgtiavgsdadivifdphvkrtlsvethhmnvdynpfeg
    mevygevvsvlsrgsfvvrdkqfvgqagsgqyikrttfeqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynyB (B:)
    kkwirggtvvtaadtyqadvliegervvaighqlsvngaeeidatgcyvipggidphthl
    dmpfggtvtaddfftgtraaafggttsivdfcltkkgeslksaiatwhekargkavidyg
    fhlmiaeandqvleelesvissegitslkvfmayknvfqaddetlfktlvkakelgalvq
    vhaengdvldyltkkalaegntdpiyhaytrppeaegeatgraialtalagsqlyvvhvs
    casavqriaearekgwnvygetcpqylaldvsimdqpdfegakyvwspplrekwnqevlw
    salkngilqtvgsdhcpfnfrgqkelgrgdftkipnggpliedrltilysegvrqgrisl
    nqfvdisstkaaklfgmfprkgtiavgsdadivifdphvkrtlsvethhmnvdynpfegm
    evygevvsvlsrgsfvvrdkqfvgqagsgqyikrttfeq