PDB entry 1ynx

View 1ynx on RCSB PDB site
Description: Solution structure of DNA binding domain A (DBD-A) of S.cerevisiae Replication Protein A (RPA)
Deposited on 2005-01-26, released 2006-01-10
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication factor-A protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RFA1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1ynxA (A:)
    trpifaieqlspyqnvwtikarvsykgeiktwhnqrgdgklfnvnfldtsgeiratafnd
    fatkfneilqegkvyyvskaklqpakpqftnlthpyelnldrdtvieecfdesn