PDB entry 1ynv

View 1ynv on RCSB PDB site
Description: Asp79 makes a large, unfavorable contribution to the stability of RNase Sa
Class: hydrolase
Keywords: Conformational stability, electrostatic strain, pKa, hydrogen bonds and ion pair., HYDROLASE
Deposited on 2005-01-25, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.154
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • engineered (93)
    Domains in SCOPe 2.07: d1ynvx_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ynvX (X:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriitgeatqedyytgdhyatfslidktc