PDB entry 1ynu

View 1ynu on RCSB PDB site
Description: Crystal structure of apple ACC synthase in complex with L-vinylglycine
Class: Lyase
Keywords: Lyase
Deposited on 2005-01-25, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.234
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate synthase
    Species: Malus x domestica [TaxId:3750]
    Gene: ACS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynua_
  • Heterogens: NI, K, PY4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynuA (A:)
    mrmlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswla
    knpeaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltaga
    tsanetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetalee
    ayqeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafss
    psfisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkms
    sfglvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglf
    cwvdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldl
    amqrlkafvgeyynvpevnggsqsshlshsrrqsltkwvsrlsfddrgpipgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynuA (A:)
    lsrnatssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaaafkk
    ngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanetfifc
    ladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeaekrnl
    rvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisvmevl
    kdsevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvssqtqhllsam
    lsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmrhllrsntfea
    emelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlkafvgeyy