PDB entry 1yns

View 1yns on RCSB PDB site
Description: Crystal Structure Of Human Enolase-phosphatase E1 and its complex with a substrate analog
Class: hydrolase
Keywords: hydrolase fold, HYDROLASE
Deposited on 2005-01-25, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E-1 enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynsa_
  • Heterogens: MG, HPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynsA (A:)
    mvvlsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllr
    kqaeedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwra
    aftagrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghf
    dtkighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltd
    dektyyslitsfselylpsst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynsA (A:)
    lsvpaevtvilldiegtttpiafvkdilfpyieenvkeylqthweeeecqqdvsllrkqa
    eedahldgavpipaasgngvddlqqmiqavvdnvcwqmsldrkttalkqlqghmwraaft
    agrmkaeffadvvpavrkwreagmkvyiyssgsveaqkllfghstegdilelvdghfdtk
    ighkvesesyrkiadsigcstnnilfltdvtreasaaeeadvhvavvvrpgnagltddek
    tyyslitsfselyl