PDB entry 1ynq

View 1ynq on RCSB PDB site
Description: aldo-keto reductase AKR11C1 from Bacillus halodurans (holo form)
Class: oxidoreductase
Keywords: aldo-keto reductase, AKR11C1, NADPH, Bacillus halodurans, OXIDOREDUCTASE
Deposited on 2005-01-25, released 2005-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH1011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KE47 (20-316)
      • cloning artifact (19)
    Domains in SCOPe 2.07: d1ynqa1, d1ynqa2
  • Chain 'B':
    Compound: Oxidoreductase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH1011
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KE47 (20-316)
      • cloning artifact (19)
    Domains in SCOPe 2.07: d1ynqb1, d1ynqb2
  • Heterogens: SUC, NA, SO4, NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynqA (A:)
    mgsshhhhhhssglvprgshmkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlel
    ginyldtadlynqglneqfvgkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikea
    vkdslrrlqtdyidlyqlhggtiddpidetieafeelkqegviryygissirpnvikeyl
    krsnivsimmqysildrrpeewfpliqehgvsvvvrgpvargllsrrplpegegylnyry
    delkllreslptdrplhelalqyclahdvvatvaagassidqvkanvqaveatpltaeer
    qhiqklakaavyeqhre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynqA (A:)
    hmkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqf
    vgkalkgrrqdiilatkvwwwdpskayikeavkdslrrlqtdyidlyqlhggtiddpide
    tieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrpeewfpliqeh
    gvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhelalqyclahdv
    vatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynqB (B:)
    mgsshhhhhhssglvprgshmkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlel
    ginyldtadlynqglneqfvgkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikea
    vkdslrrlqtdyidlyqlhggtiddpidetieafeelkqegviryygissirpnvikeyl
    krsnivsimmqysildrrpeewfpliqehgvsvvvrgpvargllsrrplpegegylnyry
    delkllreslptdrplhelalqyclahdvvatvaagassidqvkanvqaveatpltaeer
    qhiqklakaavyeqhre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynqB (B:)
    hmkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqf
    vgkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikeavkdslrrlqtdyidlyqlh
    ggtiddpidetieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrp
    eewfpliqehgvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhel
    alqyclahdvvatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre