PDB entry 1ynl

View 1ynl on RCSB PDB site
Description: Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic sweeterners: Crystal structure of NC6.8 co-crystalized with high potency sweetener compound SC45647
Class: immune system
Keywords: Triethyl aminomethane sulfonyl acid, Sweetener compound, SC45647 and NC174, IMMUNE SYSTEM
Deposited on 2005-01-24, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Ig gamma light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YNL (0-218)
    Domains in SCOPe 2.07: d1ynll1, d1ynll2
  • Heterogens: NES, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ynlL (L:)
    elvmtqsplslpvslgdqasiscrpsqslvhsngntylhwylqkpgqspklliyrvsnrf
    sgvpdrfsgsgsgtaftlkisrveaedlgvyfcsqgthvpytfgggtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec