PDB entry 1yni

View 1yni on RCSB PDB site
Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
Class: hydrolase
Keywords: Succinylarginine, Dihydrolase, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2005-01-24, released 2005-02-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76216 (12-End)
      • engineered (375)
    Domains in SCOPe 2.05: d1ynia1
  • Chain 'B':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76216 (12-End)
      • engineered (375)
    Domains in SCOPe 2.05: d1ynib_
  • Chain 'C':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76216 (12-End)
      • engineered (375)
    Domains in SCOPe 2.05: d1ynic_
  • Chain 'D':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76216 (12-End)
      • engineered (375)
    Domains in SCOPe 2.05: d1ynid_
  • Heterogens: K, SUG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yniA (A:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yniA (A:)
    nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
    ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
    dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
    lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
    idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
    tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
    gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
    ealdvlsqllnlgsvypfqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yniB (B:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yniB (B:)
    nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
    ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
    dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
    lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
    idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
    tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
    gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
    ealdvlsqllnlgsvypfqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yniC (C:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yniC (C:)
    nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
    ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
    dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
    lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
    idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
    tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
    gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
    ealdvlsqllnlgsvypfqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yniD (D:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yniD (D:)
    nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
    ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
    dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
    lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
    idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
    tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
    gpaslrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
    ealdvlsqllnlgsvypfqr