PDB entry 1ynh

View 1ynh on RCSB PDB site
Description: Crystal Structure of N-Succinylarginine Dihydrolase, AstB, bound to Substrate and Product, an Enzyme from the Arginine Catabolic Pathway of Escherichia coli
Class: hydrolase
Keywords: Succinylarginine, Dihydrolase
Deposited on 2005-01-24, released 2005-03-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.219
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ynha1
  • Chain 'B':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ynhb1
  • Chain 'C':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ynhc1
  • Chain 'D':
    Compound: Succinylarginine Dihydrolase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ynhd1
  • Heterogens: K, SUO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynhA (A:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynhA (A:)
    awevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavi
    ppherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtld
    gkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrl
    gghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvi
    dqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvst
    ylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmanggg
    paclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregre
    aldvlsqllnlgsvypfqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynhB (B:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynhB (B:)
    nawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqav
    ippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtl
    dgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnr
    lgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdv
    idqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvs
    tylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmangg
    gpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregr
    ealdvlsqllnlgsvypfqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ynhC (C:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynhC (C:)
    awevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavi
    ppherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtld
    gkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrl
    gghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvi
    dqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvst
    ylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmanggg
    paclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregre
    aldvlsqllnlgsvypfqr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ynhD (D:)
    mgsshhhhhhgsnawevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkm
    kaladagfpqavippherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwva
    naatiapsadtldgkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqva
    llgdegaanhnrlgghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnp
    qqvifaqqnpdvidqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaiev
    patqvsvsdtvstylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselk
    vfdlresmangggpaclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaa
    dladpqllregrealdvlsqllnlgsvypfqregggng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynhD (D:)
    awevnfdglvglthhyaglsfgneastrhrfqvsnprlaakqgllkmkaladagfpqavi
    ppherpfipvlrqlgfsgsdeqvlekvarqaphwlssvssaspmwvanaatiapsadtld
    gkvhltvanlnnkfhrsleapvtesllkaifndeekfsvhsalpqvallgdegaanhnrl
    gghygepgmqlfvygreegndtrpsryparqtreaseavarlnqvnpqqvifaqqnpdvi
    dqgvfhndviavsnrqvlfchqqafarqsqllanlrarvngfmaievpatqvsvsdtvst
    ylfnsqllsrddgsmmlvlpqecrehagvwgylnellaadnpiselkvfdlresmanggg
    paclrlrvvlteeerravnpavmmndtlfnalndwvdryyrdrltaadladpqllregre
    aldvlsqllnlgsvypfqr