PDB entry 1ynb

View 1ynb on RCSB PDB site
Description: crystal structure of genomics APC5600
Class: hydrolase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Sulfur SAD
Deposited on 2005-01-24, released 2005-03-08
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.206
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AF1432
    Species: Archaeoglobus fulgidus
    Gene: AF1432
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28840 (Start-172)
      • see remark 999 (42)
    Domains in SCOP 1.75: d1ynba1
  • Chain 'B':
    Compound: hypothetical protein AF1432
    Species: Archaeoglobus fulgidus
    Gene: AF1432
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28840 (Start-172)
      • see remark 999 (42)
    Domains in SCOP 1.75: d1ynbb1
  • Chain 'C':
    Compound: hypothetical protein AF1432
    Species: Archaeoglobus fulgidus
    Gene: AF1432
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28840 (Start-172)
      • see remark 999 (42)
    Domains in SCOP 1.75: d1ynbc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynbA (A:)
    mciikpmddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksges
    vekackaataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyv
    sdadklelafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynbA (A:)
    mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
    aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
    elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynbB (B:)
    mciikpmddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksges
    vekackaataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyv
    sdadklelafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynbB (B:)
    mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
    aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
    elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ynbC (C:)
    mciikpmddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksges
    vekackaataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyv
    sdadklelafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynbC (C:)
    mddvvkfihevgslkltprsgwlklgirlpesvaehnfraaiiafilalksgesvekack
    aataalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadkl
    elafqgveysqqvsyairfaenvelktdaakeiyrvlmerknpvwwr