PDB entry 1yna

View 1yna on RCSB PDB site
Description: endo-1,4-beta-xylanase, room temperature, ph 4.0
Class: hydrolase
Keywords: hydrolase, xylanase
Deposited on 1996-08-22, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.193
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Thermomyces lanuginosus [TaxId:5541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ynaA (A:)
    ettpnsegwhdgyyyswwsdggaqatytnleggtyeiswgdggnlvggkgwnpglnarai
    hfegvyqpngnsylavygwtrnplveyyivenfgtydpssgatdlgtvecdgsiyrlgkt
    trvnapsidgtqtfdqywsvrqdkrtsgtvqtgchfdawaraglnvngdhyyqivategy
    fssgyaritvadvg