PDB entry 1yn9

View 1yn9 on RCSB PDB site
Description: Crystal structure of baculovirus RNA 5'-phosphatase complexed with phosphate
Deposited on 2005-01-24, released 2005-02-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polynucleotide 5'-phosphatase
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: PTP
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: polynucleotide 5'-phosphatase
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: PTP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24656 (1-168)
      • cloning artifact (0)
  • Chain 'C':
    Compound: polynucleotide 5'-phosphatase
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Gene: PTP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yn9A (A:)
    hmfparwhnylqcgqvikdsnlicfktplrpelfayvtseedvwtaeqivkqnpsigaii
    dltntskyydgvhflragllykkiqvpgqtlppesivqefidtvkeftekcpgmlvgvhc
    thginrtgymvcrylmhtlgiapqeaidrfekarghkierqnyvqdlli
    

    Sequence, based on observed residues (ATOM records):
    >1yn9A (A:)
    mfparwhnylqcgqvikdsnlicfktplrpelfayvtseedvwtaeqivkqnpsigaiid
    ltntskyydgvhflragllykkiqvpgqtlppesivqefidtvkeftekcpgmlvgvhct
    hginrtgymvcrylmhtlgiapqeaidrfekarghkierqnyvqdlli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yn9B (B:)
    hmfparwhnylqcgqvikdsnlicfktplrpelfayvtseedvwtaeqivkqnpsigaii
    dltntskyydgvhflragllykkiqvpgqtlppesivqefidtvkeftekcpgmlvgvhc
    thginrtgymvcrylmhtlgiapqeaidrfekarghkierqnyvqdlli
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yn9C (C:)
    hmfparwhnylqcgqvikdsnlicfktplrpelfayvtseedvwtaeqivkqnpsigaii
    dltntskyydgvhflragllykkiqvpgqtlppesivqefidtvkeftekcpgmlvgvhc
    thginrtgymvcrylmhtlgiapqeaidrfekarghkierqnyvqdlli
    

    Sequence, based on observed residues (ATOM records):
    >1yn9C (C:)
    fparwhnylqcgqvikdsnlicfktplrpelfvwtaeqivkqnpsigaiidltntskyyd
    gvhflragllykkiqvpgqtlppesivqefidtvkeftekcpgmlvgvhcthginrtgym
    vcrylmhtlgiapqeaidrfekarghkierqnyvqdlli