PDB entry 1yn8

View 1yn8 on RCSB PDB site
Description: SH3 domain of yeast NBP2
Class: unknown function
Keywords: SH3 domain, UNKNOWN FUNCTION
Deposited on 2005-01-24, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8a1, d1yn8a2
  • Chain 'B':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8b1, d1yn8b2
  • Chain 'C':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8c1, d1yn8c2
  • Chain 'D':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8d1, d1yn8d2
  • Chain 'E':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8e1, d1yn8e2
  • Chain 'F':
    Compound: NAP1-binding protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12163 (1-58)
      • expression tag (0)
    Domains in SCOPe 2.06: d1yn8f1, d1yn8f2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8A (A:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8B (B:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8C (C:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8D (D:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8E (E:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yn8F (F:)
    gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq