PDB entry 1yn8
View 1yn8 on RCSB PDB site
Description: SH3 domain of yeast NBP2
Class: unknown function
Keywords: SH3 domain, UNKNOWN FUNCTION
Deposited on
2005-01-24, released
2006-05-30
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8a_ - Chain 'B':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8b_ - Chain 'C':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8c_ - Chain 'D':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8d_ - Chain 'E':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8e_ - Chain 'F':
Compound: NAP1-binding protein 2
Species: Saccharomyces cerevisiae [TaxId:4932]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1yn8f_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8A (A:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8B (B:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8C (C:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8D (D:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8E (E:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn8F (F:)
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq