PDB entry 1yn8

View 1yn8 on RCSB PDB site
Description: SH3 domain of yeast NBP2
Class: unknown function
Keywords: SH3 domain, UNKNOWN FUNCTION
Deposited on 2005-01-24, released 2006-05-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8a_
• Chain 'B':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8b_
• Chain 'C':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8c_
• Chain 'D':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8d_
• Chain 'E':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8e_
• Chain 'F':
  Compound: NAP1-binding protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12163 (1-58)
    • expression tag (0)
  Domains in SCOPe 2.01: d1yn8f_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8A (A:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8B (B:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8C (C:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8D (D:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8E (E:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yn8F (F:)
  gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq