PDB entry 1yn7

View 1yn7 on RCSB PDB site
Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a mutated peptide (R7A) of the influenza A acid polymerase
Class: immune system
Keywords: MHC class 1, H2-Db, influenza A, peptide of acid polymerase, IMMUNE SYSTEM
Deposited on 2005-01-24, released 2005-06-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1yn7a1, d1yn7a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (1-99)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d1yn7b_
  • Chain 'C':
    Compound: 10-mer peptide from RNA-directed RNA polymerase subunit P2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13175 (0-9)
      • engineered (6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yn7A (A:)
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1yn7B (B:)
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.