PDB entry 1yn7
View 1yn7 on RCSB PDB site
Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a mutated peptide (R7A) of the influenza A acid polymerase
Class: immune system
Keywords: MHC class 1, H2-Db, influenza A, peptide of acid polymerase, IMMUNE SYSTEM
Deposited on
2005-01-24, released
2005-06-28
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: H-2 class I histocompatibility antigen, D-B alpha chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1yn7a1, d1yn7a2 - Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Uniprot P01887 (1-99)
- initiating methionine (0)
Domains in SCOPe 2.02: d1yn7b_ - Chain 'C':
Compound: 10-mer peptide from RNA-directed RNA polymerase subunit P2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn7A (A:)
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1yn7B (B:)
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.