PDB entry 1yn5

View 1yn5 on RCSB PDB site
Description: Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens
Deposited on 2005-01-23, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.258
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EapH2
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: EapH2
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yn5A (A:)
    akemqnvpytiavdgimafnqsylnlpkdsqlsyldlgnkvkallydergvtpekirnak
    savytitwkdgskkevdlkkdsytanlfdsnsikqidinvktk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yn5B (B:)
    akemqnvpytiavdgimafnqsylnlpkdsqlsyldlgnkvkallydergvtpekirnak
    savytitwkdgskkevdlkkdsytanlfdsnsikqidinvktk
    

    Sequence, based on observed residues (ATOM records):
    >1yn5B (B:)
    mqnvpytiavdgimafnqsylnlpkdsqlsyldlgnkvkallydergvtpekirnaksav
    ytitwkdgskkevdlkkdsytanlfdsnsikqidinvktk